DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mccc2 and mrpl-44

DIOPT Version :9

Sequence 1:NP_652724.1 Gene:Mccc2 / 59261 FlyBaseID:FBgn0042083 Length:578 Species:Drosophila melanogaster
Sequence 2:NP_499012.2 Gene:mrpl-44 / 176285 WormBaseID:WBGene00008514 Length:394 Species:Caenorhabditis elegans


Alignment Length:162 Identity:33/162 - (20%)
Similarity:66/162 - (40%) Gaps:19/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 SIIVKKQGTIFLAGPP--LVKAATGEEVSAEDLGGADLHCKTSGVTDHYALDDEHALYLARQIVS 291
            ||.:|:.....||..|  |::|.....:..|.|.|...|.   |: ||.....|..  ::::..:
 Worm   123 SIWLKRYLRFHLAKAPEELIEAIDSHLLDDECLAGIASHL---GI-DHLVRTKEFP--ISQESSA 181

  Fly   292 NLNLSATNSYNDQLMHSSQVNFQTATPPSAVEEPRYDAEELYGIVGP-----NLTKSFDVREVIA 351
            :...:....::|:.:.:..::|   ..|..|:   .|..::|.:..|     :|.||..|.|:..
 Worm   182 DAFRALAGVFSDEKVKNLVIDF---IVPQLVD---IDFADIYPLADPLAVVTDLLKSNGVTEIEP 240

  Fly   352 RIVDGSRFTEFKKLYGETLVCGFAKLYGHTVG 383
            |::..:.....:.:|...:.....|..|.:.|
 Worm   241 RVLRSAGENSAEPIYVVAIYADKLKNVGQSAG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mccc2NP_652724.1 PLN02820 27..578 CDD:178415 33/162 (20%)
crotonase-like <82..254 CDD:304874 8/26 (31%)
crotonase-like <359..>487 CDD:304874 4/25 (16%)
mrpl-44NP_499012.2 DSRM_MRPL44 209..293 CDD:380703 14/67 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11145
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D194285at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.