DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tgs1 and AT1G30550

DIOPT Version :9

Sequence 1:NP_732316.2 Gene:Tgs1 / 59260 FlyBaseID:FBgn0266195 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001319114.1 Gene:AT1G30550 / 839935 AraportID:AT1G30550 Length:239 Species:Arabidopsis thaliana


Alignment Length:209 Identity:91/209 - (43%)
Similarity:137/209 - (65%) Gaps:6/209 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 NNKMVKYWVKRFSLFSRFDQGIRLDRESWFSVTPEKIAKQTARRLACDVIVDAFCGCGGNAIQFA 317
            |.|:.:||::|:.|||::||||.:|.|.|:|||||:||.:.|.|....|::|.|.|.|||.||||
plant    34 NPKISRYWIQRYDLFSKYDQGIEMDEEGWYSVTPEEIAIKQAERCRGKVVIDCFSGVGGNTIQFA 98

  Fly   318 NTCGRVIAVDIDAEKLAMAKHNAGIYGVAHKIEFIHADFLQFAASTKLRPNVVFLSPPWGGPDYQ 382
            ..|..|||:|||..|:|:|.:||.:||||::|:|:..||:|.|.|  |:.:|:|||||||||.|.
plant    99 KVCSSVIAIDIDPMKIALAMNNAKVYGVANRIDFVTGDFMQLAPS--LKGDVLFLSPPWGGPTYS 161

  Fly   383 KQATFDIETGLLPVGASQLMQLSRSLASDVAFFLPRN---ANMKQVVALSGVGQQCEVEHNYLDT 444
            |..::.::. |||.....|.|.:.|:..::..|||:|   |.::::..||......|:|.|.:..
plant   162 KVESYKLDM-LLPRDGYSLFQTALSITPNIIMFLPKNIDLAQLEELACLSSPPLTLEIEENSIGG 225

  Fly   445 RMVALTAYYGKGII 458
            .:.|:|||:...::
plant   226 EIKAITAYFSSNVV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tgs1NP_732316.2 Methyltransf_15 299..455 CDD:286524 67/158 (42%)
AT1G30550NP_001319114.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 147 1.000 Domainoid score I1450
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002744
OrthoInspector 1 1.000 - - otm3282
orthoMCL 1 0.900 - - OOG6_102135
Panther 1 1.100 - - LDO PTHR14741
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2121
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.