Sequence 1: | XP_016877049.1 | Gene: | ARID4A / 5926 | HGNCID: | 9885 | Length: | 1284 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001163639.1 | Gene: | osa / 42130 | FlyBaseID: | FBgn0261885 | Length: | 2716 | Species: | Drosophila melanogaster |
Alignment Length: | 240 | Identity: | 58/240 - (24%) |
---|---|---|---|
Similarity: | 85/240 - (35%) | Gaps: | 81/240 - (33%) |
- Green bases have known domain annotations that are detailed below.
Human 238 PES----ELSTKPGLQK------ASIFLKTRVV---PDNWKMD----ISEILESSSSDDED---- 281
Human 282 -------------------------------GPAEENDEEKEKEAKK--------TEEEVPEE-- 305
Human 306 -----------------ELDPE-ERDNFLQQLYKFMEDRGTPINKPPVLGYKDLNLFKLFRLVYH 352
Human 353 QGGCDNIDSGAVWKQIYMDLGIPILNSAASYNVKTAYRKYLYGFE 397 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ARID4A | XP_016877049.1 | None | |||
osa | NP_001163639.1 | BRIGHT | 1001..1092 | CDD:128777 | 31/88 (35%) |
DUF3518 | 2191..2451 | CDD:288854 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1374 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |