DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARID4A and osa

DIOPT Version :9

Sequence 1:XP_016877049.1 Gene:ARID4A / 5926 HGNCID:9885 Length:1284 Species:Homo sapiens
Sequence 2:NP_001163639.1 Gene:osa / 42130 FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster


Alignment Length:240 Identity:58/240 - (24%)
Similarity:85/240 - (35%) Gaps:81/240 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   238 PES----ELSTKPGLQK------ASIFLKTRVV---PDNWKMD----ISEILESSSSDDED---- 281
            |||    .:|...|:..      |.:...|.||   ||...||    .|.:..:|::..||    
  Fly   849 PESGGPEHISQDNGISSSGPTGAAGMHAVTSVVTTGPDGTSMDEVSQQSTLSNASAASGEDPQCT 913

Human   282 -------------------------------GPAEENDEEKEKEAKK--------TEEEVPEE-- 305
                                           ||.||.|........:        ....||:|  
  Fly   914 TPKSRKNDPYSQSHLAPPSTSPHPVVMHPGGGPGEEYDMSSPPNWPRPAGSPQVFNHVPVPQEPF 978

Human   306 -----------------ELDPE-ERDNFLQQLYKFMEDRGTPINKPPVLGYKDLNLFKLFRLVYH 352
                             |:|.. :|..:|.:|..|||:|.|||...|.:..:.|:|::|:..|..
  Fly   979 RSTITTTKKSDSLCKLYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKE 1043

Human   353 QGGCDNIDSGAVWKQIYMDLGIPILNSAASYNVKTAYRKYLYGFE 397
            :||...:.....||.|...|||. .:|:|:|.::..|.|.|..||
  Fly  1044 RGGFVEVTKSKTWKDIAGLLGIG-ASSSAAYTLRKHYTKNLLTFE 1087

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARID4AXP_016877049.1 None
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 31/88 (35%)
DUF3518 2191..2451 CDD:288854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1374
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.