DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARID4A and msl-3

DIOPT Version :9

Sequence 1:XP_016877049.1 Gene:ARID4A / 5926 HGNCID:9885 Length:1284 Species:Homo sapiens
Sequence 2:NP_523951.1 Gene:msl-3 / 38779 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster


Alignment Length:451 Identity:75/451 - (16%)
Similarity:153/451 - (33%) Gaps:129/451 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   577 TKVKVKYGRGKTQKIYEASIKSTEIDDGEVLYLVHYYGWNVRYDEWVKADRIIWPLDKGGPKKKQ 641
            :|.:|.|    |.|:.....:..|.......|.:|:.||...||..|:|..::            
  Fly    25 SKARVLY----TSKVLNVFERRNEHGLRFYEYKIHFQGWRPSYDRCVRATVLL------------ 73

Human   642 KKKAKNKEDSEKDEKRDEERQKSKRGRPPLKSTLSSNMPYGLSKTANSEGKSGTRSARSNIPDSS 706
                   :|:|  |.|..:|:.::..:..::...|..   |.....:::.|.|.::|....|...
  Fly    74 -------KDTE--ENRQLQRELAEAAKLQIRGDYSYK---GTPDKPSAKKKRGGKAAHVEEPIVV 126

Human   707 PLSNG------------------MEDSCSSDSETEDALEKNLINEELSLKDELEKNENLNDDKLD 753
            |:..|                  ..|:.....:.:.......:......:.|...|..:||    
  Fly   127 PMDTGHLEAEHEMAPTPRAAGNRTRDNSGGKRKEKPPSGDGRLKGNRGRQTETFYNNAIND---- 187

Human   754 EENPKISAHILKENDRTQMQPLETLKLEVGENEQIVQIFGNK------------MEKTEEVKKEA 806
               ..:..|:.:| ||..|:..|.|:..:..:..::::.|.:            ||..  ||::|
  Fly   188 ---VSVYNHVPQE-DRIMMRVSERLRELIEYDRNMIKVLGKQHALPARVPIVTIMENF--VKQQA 246

Human   807 --------EKSPKGKGRRSKTKDLSLEIIKISS---------------FGQNEAGSEPHIEAHSL 848
                    :.|.:.:..:|:...:..|..::.|               |       |.|::.|  
  Fly   247 VELAISIKQDSSRARNTQSRNARMEREYDRVMSTVCMLKEVVDGLRIYF-------EFHVDDH-- 302

Human   849 ELSSLDNKNF--SSATEDEIDQCVKEKKLKRKILGQSSPEKKIRIENGMEMTNTVSQERTSDCIG 911
             |...:.|.:  :..|:|.:..|........:.:..|...:.|    |::.|..|  |.:.|..|
  Fly   303 -LLYTEEKEYVHNYLTDDNMRNCSLILNKSYEYINPSGDTELI----GLDGTPVV--EGSGDTNG 360

Human   912 SEGMKNLNFEQHFERENEGMPSLIAESNQCIQQL-------TSERFD--SPAEETVNIPLK 963
            ..|:.|:           |.|....:..:|:..:       |::.::  ||......:|::
  Fly   361 QIGVINI-----------GGPEYEKQLQKCLLYIVTASGKNTAQAYERTSPYTAAYKLPVE 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARID4AXP_016877049.1 None
msl-3NP_523951.1 MRG 196..486 CDD:283390 42/245 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3001
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.