DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18508 and RGD1562987

DIOPT Version :9

Sequence 1:NP_001284836.1 Gene:CG18508 / 59253 FlyBaseID:FBgn0028746 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_001166943.1 Gene:RGD1562987 / 498886 RGDID:1562987 Length:72 Species:Rattus norvegicus


Alignment Length:107 Identity:31/107 - (28%)
Similarity:47/107 - (43%) Gaps:44/107 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVCVPCIIIPLLLYIWHKFVQPILLRYWNP-----WEKKD----DDGNVIKKGPDFPFECKGGVC 56
            |||:|||:||:||:|:.||::|    |..|     |.:|.    |:.|..|      .:|||   
  Rat     1 MVCIPCIVIPVLLWIFKKFLEP----YIYPVVSRIWPRKAVQQLDNKNTGK------VDCKG--- 52

  Fly    57 PFVPGGKKTENVSDDDAEESENPPLNATAMAAETEVDESKKE 98
                        :|.:...::.|          |||.:.||:
  Rat    53 ------------ADTNGFSTKGP----------TEVSDKKKD 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18508NP_001284836.1 DUF4512 2..96 CDD:291636 28/102 (27%)
RGD1562987NP_001166943.1 Necessary for its localzation to the endoplasmic reticulum and lipid droplets. /evidence=ECO:0000250|UniProtKB:Q8TCD1 1..33 16/35 (46%)
DUF4512 2..>38 CDD:405640 17/39 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..72 10/57 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1627271at2759
OrthoFinder 1 1.000 - - FOG0007529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_111113
Panther 1 1.100 - - LDO PTHR13456
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.