DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18508 and C18h18orf32

DIOPT Version :10

Sequence 1:NP_652721.1 Gene:CG18508 / 59253 FlyBaseID:FBgn0028746 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_001166943.1 Gene:C18h18orf32 / 498886 RGDID:1562987 Length:72 Species:Rattus norvegicus


Alignment Length:107 Identity:31/107 - (28%)
Similarity:47/107 - (43%) Gaps:44/107 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVCVPCIIIPLLLYIWHKFVQPILLRYWNP-----WEKKD----DDGNVIKKGPDFPFECKGGVC 56
            |||:|||:||:||:|:.||::|    |..|     |.:|.    |:.|..|      .:|||   
  Rat     1 MVCIPCIVIPVLLWIFKKFLEP----YIYPVVSRIWPRKAVQQLDNKNTGK------VDCKG--- 52

  Fly    57 PFVPGGKKTENVSDDDAEESENPPLNATAMAAETEVDESKKE 98
                        :|.:...::.|          |||.:.||:
  Rat    53 ------------ADTNGFSTKGP----------TEVSDKKKD 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18508NP_652721.1 DUF4512 2..96 CDD:405640 28/102 (27%)
C18h18orf32NP_001166943.1 Necessary for its localzation to the endoplasmic reticulum and lipid droplets. /evidence=ECO:0000250|UniProtKB:Q8TCD1 1..33 16/35 (46%)
DUF4512 2..>38 CDD:405640 17/39 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..72 10/57 (18%)

Return to query results.
Submit another query.