DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18508 and C18orf32

DIOPT Version :10

Sequence 1:NP_652721.1 Gene:CG18508 / 59253 FlyBaseID:FBgn0028746 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_001030177.1 Gene:C18orf32 / 497661 HGNCID:31690 Length:76 Species:Homo sapiens


Alignment Length:110 Identity:28/110 - (25%)
Similarity:42/110 - (38%) Gaps:46/110 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVCVPCIIIPLLLYIWHKFVQPILLRYWNP-----WEKK-------DDDGNVIKKGPDFPFECKG 53
            |||:|||:||:||:|:.||::|.:....:|     |.||       .:.|.|..||.|       
Human     1 MVCIPCIVIPVLLWIYKKFLEPYIYPLVSPFVSRIWPKKAIQESNDTNKGKVNFKGAD------- 58

  Fly    54 GVCPFVPGGKKTENVSDDDAEESENPPLNATAMAAETEVDESKKE 98
                                       :|.......||:.:.||:
Human    59 ---------------------------MNGLPTKGPTEICDKKKD 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18508NP_652721.1 DUF4512 2..96 CDD:405640 25/105 (24%)
C18orf32NP_001030177.1 Necessary for its localzation to the endoplasmic reticulum and lipid droplets 1..37 15/35 (43%)
DUF4512 2..>46 CDD:405640 17/43 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..76 9/63 (14%)

Return to query results.
Submit another query.