DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18508 and F18A11.3

DIOPT Version :9

Sequence 1:NP_001284836.1 Gene:CG18508 / 59253 FlyBaseID:FBgn0028746 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_496772.2 Gene:F18A11.3 / 174946 WormBaseID:WBGene00008930 Length:84 Species:Caenorhabditis elegans


Alignment Length:99 Identity:26/99 - (26%)
Similarity:45/99 - (45%) Gaps:17/99 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVCVPCIIIPLLLYIWHKFVQPILLRYWNPWEKKDDDGNVIKKGPDFPFECKGGVCPF-VPGGKK 64
            |||:|||.:|:::.|:.||:.|.:.|.            :.::..:|........||. :|..:.
 Worm     1 MVCLPCIFLPIMMAIYMKFIMPYVYRV------------LPQRWVNFLDPILYPTCPVKIPEPEN 53

  Fly    65 TENVSDDDAEESENPPLNATAMAAETEVDESKKE 98
            .:.|.    ||.::.|..|....|..|..|:||:
 Worm    54 KKEVE----EEKKDAPCCANTTEATVETVETKKD 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18508NP_001284836.1 DUF4512 2..96 CDD:291636 23/94 (24%)
F18A11.3NP_496772.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_111113
Panther 1 1.100 - - LDO PTHR13456
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.960

Return to query results.
Submit another query.