DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18530 and YEH1

DIOPT Version :9

Sequence 1:NP_652714.2 Gene:CG18530 / 59241 FlyBaseID:FBgn0042207 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_013089.1 Gene:YEH1 / 850648 SGDID:S000003935 Length:573 Species:Saccharomyces cerevisiae


Alignment Length:387 Identity:81/387 - (20%)
Similarity:151/387 - (39%) Gaps:72/387 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HNYPVEIHTVVTRDGYLLNAFRIPNSIYCEQSGTK--PAVLFQHGMTASSDVFLVNGPRDALPFM 90
            :|..:|...:.|.||::::.:.:........|..|  |.:|..||:..||..|..|| |.:|.:.
Yeast   185 YNIQIEEFRLETEDGFVIDLWHLIPKYRTTDSDKKKRPPILMLHGLLQSSGSFASNG-RKSLAYF 248

  Fly    91 LADACFDVWLSNSR-GTRYSRRHVSLDPSDEDFWRFSWHEIGTEDVAAFIDYILGTTNQSAVHYV 154
            |..:.:|:||.|:| |.|.......: |:....|.:...|:...|:...||.:|..|....:..:
Yeast   249 LYQSGYDIWLGNNRCGFRPEWNEAKV-PTLASRWDWDLREMVKYDLTLLIDTVLAKTQFEKLTLI 312

  Fly   155 GHSQGCTTLVVLL------------SMRPEYNQFVKTAILLGPPVFMGHTHTLGQIFLRTLIMSM 207
            .||||.|...:.|            |....:...:...|.|.|.|:.|.... .::|::.:...:
Yeast   313 SHSQGTTQGFMGLVNEDKFFPPGSGSKESFFTSKIANYIALAPAVYPGPLLN-EKLFVKLMTKEI 376

  Fly   208 PDCEFMFHNRI--LNKILRRIC-GLFVVRVYCSTFFMIVNGKF--SDHLNTSAIPLIAATLPAGV 267
            .:..|......  :..|:|.:| |..:....|.|.|   |..|  :|.|..:|:           
Yeast   377 ENPWFFGETSFFEIMMIVRNLCVGESLFSFVCYTIF---NYLFDWNDTLWDTAL----------- 427

  Fly   268 SSRQPKHFIQLTDSGRFRPFDFGIL---------RNLINYRSLTPPDYPLHNVRPLTP------V 317
               :.:||:       |.|....:.         .|.::::..:...:| .||:..:.      :
Yeast   428 ---RDRHFL-------FSPVHVSVKLMQWWLSPDPNKVSFKFGSHKMFP-DNVKWFSDASKAPNI 481

  Fly   318 HIFYSDDDLSAAKEDVENFATSLPEAVMHRISTPSWH-----HMDFVHSMTVANVINKPVIE 374
            ::|....|.....|.:.|...::...|.::|    |:     |:|.:.:..|...|.||:::
Yeast   482 YLFVPKQDRLVDGERLINHFVNVESNVNYKI----WYIDEYAHIDVLWAHDVIERIGKPILQ 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18530NP_652714.2 PLN02872 22..377 CDD:215470 81/387 (21%)
Abhydro_lipase 22..82 CDD:282003 14/55 (25%)
YEH1NP_013089.1 PLN02872 169..>326 CDD:215470 39/142 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341633
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.