DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18530 and Gm8978

DIOPT Version :9

Sequence 1:NP_652714.2 Gene:CG18530 / 59241 FlyBaseID:FBgn0042207 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001310180.1 Gene:Gm8978 / 668106 MGIID:3647649 Length:399 Species:Mus musculus


Alignment Length:398 Identity:113/398 - (28%)
Similarity:204/398 - (51%) Gaps:24/398 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KTLVILSVCTQIV----------NGITSAEIIASHNYPVEIHTVVTRDGYLLNAFRIPNSIYCEQ 58
            :|:.::.|..:|.          :.:..:|||....||.|.:.|||.|||:|...|||:......
Mouse     6 RTMCLIHVLGKIFCLIGQNKNPESNMNVSEIIKHWEYPSEEYEVVTDDGYILPINRIPHGKNNAN 70

  Fly    59 SGTKPAVLF-QHGMTASSDVFLVNGPRDALPFMLADACFDVWLSNSRGTRYSRRHVSLDPSDEDF 122
            |.....|:| .||:.:::.:::.|.|.::|.|:||||.:||||.|:||:..:::||:|:...::|
Mouse    71 STAPKMVVFCLHGLFSTAGIWVSNPPDNSLAFILADAGYDVWLGNNRGSTRAKKHVTLNTDSKEF 135

  Fly   123 WRFSWHEIGTEDVAAFIDYILGTTNQSAVHYVGHSQGCTTLVVL--LSMRPEYNQFVKTAILLGP 185
            |.||:.|:...|:.|.|.:||..|.|..::|.|||||  ||:.|  .:...|..:.:|.:||:.|
Mouse   136 WAFSYDEMIKYDLPAIIKFILEKTGQKQIYYTGHSQG--TLIALGAFATNQELAEKIKLSILIAP 198

  Fly   186 PVFMGHTHTLGQI---FLRTLIMSMPDCEFMFHNRILNKILRRICGLFVVRVYCSTFFMIVNGKF 247
            ...:.:....|::   |..|....:...:..|..::.:::.:.:|.:.:|...|:|....:.|..
Mouse   199 VHTVKYVKGAGRLPAYFTPTAFKIVFGEKEFFPTKVFSRLSQHVCDIKLVDAGCATVLGSLTGYS 263

  Fly   248 SDHLNTSAIPLIAATLPAGVSSRQPK-HFIQLTDSGRFRPFDFGI-LRNLINYRSLTPPDYPLHN 310
            .:..|||.|. :..|...|.||.|.. |:.|...||.|:.:|:|. ..|:.:|...|||.|.:.:
Mouse   264 PEQFNTSRID-VYITHSLGESSIQILIHYGQAIRSGVFQAYDWGSPSLNMQHYNQTTPPVYNVED 327

  Fly   311 VRPLTPVHIFYSDDDLSAAKEDVENFATSLPEAVMHRISTPSWHHMDFVHSMTVANVINKPVIEI 375
            ::  .|..:|....|..:..|||.|....:.....|:|.: .:.|:||:..:.....:::.::.|
Mouse   328 MK--VPTAMFSGLKDFLSNPEDVANLVPKISNLTYHKIIS-DFSHLDFIMGLNARKEVSEEILTI 389

  Fly   376 FKRFEQPI 383
            .::::..|
Mouse   390 LRKYDGDI 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18530NP_652714.2 PLN02872 22..377 CDD:215470 109/362 (30%)
Abhydro_lipase 22..82 CDD:282003 21/60 (35%)
Gm8978NP_001310180.1 PLN02872 17..391 CDD:215470 110/379 (29%)
Abhydro_lipase 33..94 CDD:282003 21/60 (35%)
Abhydrolase_5 77..242 CDD:289465 52/166 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831779
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.