DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18530 and Lip2

DIOPT Version :9

Sequence 1:NP_652714.2 Gene:CG18530 / 59241 FlyBaseID:FBgn0042207 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_524667.1 Gene:Lip2 / 43980 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster


Alignment Length:395 Identity:110/395 - (27%)
Similarity:180/395 - (45%) Gaps:61/395 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TSAEIIASHNYPVEIHTVVTRDGYLLNAFRIPNSIYCEQSGTKPAVLFQHGMTASSDVFLVNGPR 84
            |:.:.:.:.|...|:|.|.|.|||.|...|:|      :.|.|| ||..||:..||..::..||.
  Fly    35 TTMDWLEAQNVSHEVHNVTTADGYQLQLQRLP------RLGAKP-VLLVHGLLGSSLGWVCMGPE 92

  Fly    85 DALPFMLADACFDVWLSNSRG-TRYSRRHVSLDPSDEDFWRFSWHEIGTEDVAAFIDYILGTT-- 146
            .:|.|.|....:||||:|.|| :.|.|:|:.|.....:|||||:||.|..|:.|.||::...|  
  Fly    93 RSLAFQLHHREYDVWLANLRGVSPYGRQHIDLTDVMVEFWRFSFHEHGAYDLPAIIDHMAKVTGG 157

  Fly   147 -----------NQSAVHY----VGHSQGCTTLVVLLSMRPEYNQFVKTAILLGPPVFMGHTHTLG 196
                       ::..:|:    :||||.....:||.::.|.:||.::....|.|         |.
  Fly   158 EQLASRGGPGQDEEQIHHQVVLIGHSQAFNAFLVLCAVHPRFNQRIQLIQALAP---------LA 213

  Fly   197 QIFLRTLIMSMPDCEFMFHNRILNKILRRICGLFVVRVYCSTFFMIVNGKFSDHLNTSAIPLIAA 261
            ::..:....|       |..|.|.|.:::....:...::...:|..|.....|.....|..|:.:
  Fly   214 RLHRQVRFDS-------FQVRRLMKFIKKRQKAYKFEIFPPGYFRKVCQAKRDLCEYYAKQLVGS 271

  Fly   262 T--------------LPAGVSSRQPKHFIQLTDSGRFRPFDFGILRNLINYRSLTPPDYPLHNVR 312
            .              |..|.|.|:.||..|:..||.|..:|||...||..|.|:....|   |:.
  Fly   272 AQNNKKLLEAFNYEYLLQGGSPREIKHLQQIWKSGDFISYDFGTAENLQVYHSVEALSY---NIS 333

  Fly   313 PLT-PVHIFYSDDDLSAAKEDVENFATSLPEAV--MHRISTPSWHHMDFVHSMTVANVINKPVIE 374
            .:| |:.:::.:.|..|..|.|......:..:|  :.||::..::|:||:.|..|.:::|..:||
  Fly   334 QITVPIILYFGETDAIATPEGVHAIYARMLRSVKSVRRINSKKFNHLDFLISGDVKSLVNDKLIE 398

  Fly   375 IFKRF 379
            ..::|
  Fly   399 HMEQF 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18530NP_652714.2 PLN02872 22..377 CDD:215470 108/389 (28%)
Abhydro_lipase 22..82 CDD:282003 20/59 (34%)
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 110/395 (28%)
Abhydro_lipase 48..90 CDD:282003 19/48 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439538
Domainoid 1 1.000 108 1.000 Domainoid score I1418
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm46497
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
98.850

Return to query results.
Submit another query.