DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18530 and LIPA

DIOPT Version :9

Sequence 1:NP_652714.2 Gene:CG18530 / 59241 FlyBaseID:FBgn0042207 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_000226.2 Gene:LIPA / 3988 HGNCID:6617 Length:399 Species:Homo sapiens


Alignment Length:374 Identity:116/374 - (31%)
Similarity:178/374 - (47%) Gaps:27/374 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AEIIASHNYPVEIHTVVTRDGYLLNAFRIPNS-IYCEQSGTKPAVLFQHGMTASSDVFLVNGPRD 85
            :|||:...:|.|.:.|.|.|||:|...|||:. ......|.||.|..|||:.|.|..::.|....
Human    38 SEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANS 102

  Fly    86 ALPFMLADACFDVWLSNSRGTRYSRRHVSLDPSDEDFWRFSWHEIGTEDVAAFIDYILGTTNQSA 150
            :|.|:||||.||||:.||||..:||:|.:|..|.::||.||:.|:...|:.|.|::||..|.|..
Human   103 SLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQ 167

  Fly   151 VHYVGHSQGCTTLVVLLSMRPEYNQFVKTAILLGPPVFMGH------------THTLGQIFLRTL 203
            |:|||||||.|...:..|..||..:.:|....|||...:..            .|.:..:|    
Human   168 VYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLF---- 228

  Fly   204 IMSMPDCEFMFHNRILNKILRRICGLFVVRVYCSTFFMIVNGKFSDHLNTSAIPLIAATLPAGVS 268
                .|.||:..:..|..:...:|...:::..|.....::.|....:||.|.:.:.....|||.|
Human   229 ----GDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTS 289

  Fly   269 SRQPKHFIQLTDSGRFRPFDFG-ILRNLINYRSLTPPDYPLHNVRP-LTPVHIFYSDDDLSAAKE 331
            .:...|:.|.....:|:.||:| ..:|..:|....||.|   ||:. |.|..::....|..|...
Human   290 VQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTY---NVKDMLVPTAVWSGGHDWLADVY 351

  Fly   332 DVENFATSLPEAVMHRISTPSWHHMDFVHSMTVANVINKPVIEIFKRFE 380
            ||....|.:...|.|. |.|.|.|:||:..:.....:...:|.:.::::
Human   352 DVNILLTQITNLVFHE-SIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18530NP_652714.2 PLN02872 22..377 CDD:215470 116/369 (31%)
Abhydro_lipase 22..82 CDD:282003 23/60 (38%)
LIPANP_000226.2 PLN02872 38..396 CDD:215470 116/369 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141797
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.