DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GTT1

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:217 Identity:55/217 - (25%)
Similarity:88/217 - (40%) Gaps:52/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LGVEFD---KKTIINTRAREQFTPEYLKINPQHTIPTL----HDHG--FALWESRAIMVYLVEKY 77
            |.:|::   .|...|.||    .||..||:|....|.|    .:.|  ..|.||..|..|:::.:
Yeast    26 LNLEYEIVPYKRDANFRA----PPELKKIHPLGRSPLLEVQDRETGKKKILAESGFIFQYVLQHF 86

  Fly    78 GKDDKLFPKDVQKQALINQRLYFDMGTLYKSF-----------SEYYYPQIFL-KKPANE--ENY 128
            .....|..:|......||..|::..|:|....           |...:|..:| :|.|::  :.|
Yeast    87 DHSHVLMSEDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSGMPFPISYLARKVADKISQAY 151

  Fly   129 KKIEVAFEFLNTFLEGQT-----YSAGGDYSLADIAFLATVSTFDVAGFDFKR-------YANVA 181
            ...||..:|  .|:||:.     |...|..|.|||     :.:|.:. ..|:|       |..::
Yeast   152 SSGEVKNQF--DFVEGEISKNNGYLVDGKLSGADI-----LMSFPLQ-MAFERKFAAPEDYPAIS 208

  Fly   182 RWYENAKKLTPGWEENWAGCQE 203
            :|   .|.:|.  ||::|..:|
Yeast   209 KW---LKTITS--EESYAASKE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 19/61 (31%)
PLN02473 3..196 CDD:166114 51/208 (25%)
GST_C_Delta_Epsilon 89..205 CDD:198287 34/141 (24%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 19/64 (30%)
GST_C_GTT1_like 93..218 CDD:198298 31/137 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.