DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and YGR201C

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:208 Identity:46/208 - (22%)
Similarity:83/208 - (39%) Gaps:24/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTL---HDHGFALWESRAIMVYLV 74
            |:::.......::.|.|....:.|::.:..|:    |....||.   ||. :.|.|:.||..||:
Yeast    17 RTIVPRGLVRSLKLDVKLADPSDAQQLYEREF----PLRKYPTFVGPHDE-WTLTEAMAIDYYLI 76

  Fly    75 ----EKYGKDDKLFPK-DVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYK----K 130
                :|......|.|: |.:.:|.|.:..............|.::|.|.: ||.|...:|    .
Yeast    77 HLSSDKEAVRQLLGPEGDFKTRADILRWESLSNSDFLNEVCEVFFPLIGV-KPYNATEFKAAREN 140

  Fly   131 IEVAFEFLNTFLEGQTYSAGGDY-SLADIAFLATVSTFDVAGFD---FKRYANVARWYENA--KK 189
            ::.........|:.|.|....|: :|||:...|..|...::.||   ..::..|.||:...  .:
Yeast   141 VDTIVSLYEKRLKKQQYLVCDDHETLADLISAAAFSLGFISFFDETWRSKHPEVTRWFNRVIKSR 205

  Fly   190 LTPGWEENWAGCQ 202
            ...|..|::..|:
Yeast   206 FFEGEFESFKMCE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 16/68 (24%)
PLN02473 3..196 CDD:166114 44/200 (22%)
GST_C_Delta_Epsilon 89..205 CDD:198287 26/124 (21%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 16/65 (25%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345050
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.