DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and clic3

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_955818.1 Gene:clic3 / 84040 ZFINID:ZDB-GENE-010507-2 Length:239 Species:Danio rerio


Alignment Length:213 Identity:48/213 - (22%)
Similarity:74/213 - (34%) Gaps:52/213 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GSAP-CRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLK-INPQHTIPTLHDHGFALWESRAIM 70
            |:.| |:.:.|.....||.|...|:...||     ||.|| :.|....|.|..:|....::..|.
Zfish    21 GNCPFCQRLFMILWLKGVNFTLTTVDMKRA-----PEVLKDLAPGSQPPFLIYNGEVRTDTNKIE 80

  Fly    71 VYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGT----LYKSFSEYYYPQIFLKKP---ANEENY 128
            .:|      :|.|.|....|...    .|.:..|    ::..||.|      :|.|   .|:...
Zfish    81 EFL------EDTLAPPQYPKLCC----RYKESNTAGDDIFHKFSAY------IKNPNPGLNDMLE 129

  Fly   129 KKIEVAFEFLNTFL----------------EGQTYSAGGDYSLADIAFLATVSTFDVA-----GF 172
            ||...:...|:.:|                ..:.|..|...||||...|..:....|.     ||
Zfish   130 KKFLKSLMKLDQYLLTPLPHELDQNPELSTSTRHYLDGNALSLADCNLLPKLHIVKVVCKKYRGF 194

  Fly   173 DF-KRYANVARWYENAKK 189
            :. .....::::.:.|.|
Zfish   195 EIPAELKGLSKYLDKAYK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 20/68 (29%)
PLN02473 3..196 CDD:166114 48/213 (23%)
GST_C_Delta_Epsilon 89..205 CDD:198287 25/130 (19%)
clic3NP_955818.1 GST_N_CLIC 3..92 CDD:239359 23/81 (28%)
O-ClC 6..237 CDD:129941 48/213 (23%)
GST_C_CLIC3 99..231 CDD:198332 24/120 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589602
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.