DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GSTF6

DIOPT Version :10

Sequence 1:NP_652713.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_171792.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:174 Identity:37/174 - (21%)
Similarity:65/174 - (37%) Gaps:30/174 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESR 67
            ::..|.|...|.||:......|:|: ...:..:..|.....::..||...:|...|..|.::|||
plant     6 VFGHPASTATRRVLIALHEKNVDFE-FVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKIFESR 69

  Fly    68 AIMVYLVEKY----------GKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLK-- 120
            ||..|:..::          |||..:....::    |....:..:|      |:..:.|: ||  
plant    70 AITQYIAH
EFSDKGNNLLSTGKDMAIIAMGIE----IESHEFDPVG------SKLVWEQV-LKPL 123

  Fly   121 ------KPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADI 158
                  |...||...|:....:.....|....|.|...::|.|:
plant   124 YGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDHFTLVDL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_652713.1 GST_N_Delta_Epsilon 1..75 CDD:239343 19/71 (27%)
GST_C_Delta_Epsilon 89..205 CDD:198287 15/78 (19%)
GSTF6NP_171792.1 GST_N_Phi 4..77 CDD:239351 19/71 (27%)
GST_C_Phi 91..208 CDD:198296 17/88 (19%)

Return to query results.
Submit another query.