DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GSTF5

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:223 Identity:56/223 - (25%)
Similarity:85/223 - (38%) Gaps:51/223 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESR 67
            :|..|.|...|.||......|:.:|..| :|..|.:|..|.:|.|||...:|...|.|..|.|||
plant    66 IYGYPYSTNTRRVLAVLHEKGLSYDPIT-VNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESR 129

  Fly    68 AIMVYLVEKYGKDDKLFPKDVQKQ---ALINQRLYFDMGT--LYKSFSEYYY------------- 114
            ||..|:.            .|.|.   .|:|.:.|..|||  ::.:...:.:             
plant   130 AISEYIA------------TVHKSRGTQLLNYKSYKTMGTQRMWMAIESFEFDPLTSTLTWEQSI 182

  Fly   115 -PQIFLK---KPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFD-- 173
             |...||   |..||.. .|:|...:.....|:..::.|...:::||:..|..:...    .|  
plant   183 KPMYGLKTDYKVVNETE-AKLEKVLDIYEERLKNSSFLASNSFTMADLYHLPNIQYL----MDTH 242

  Fly   174 ----FKRYANVARWYENAKKLT--PGWE 195
                |....:|.||   ..::|  |.|:
plant   243 TKRMFVNRPSVRRW---VAEITARPAWK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 27/71 (38%)
PLN02473 3..196 CDD:166114 56/223 (25%)
GST_C_Delta_Epsilon 89..205 CDD:198287 28/137 (20%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 27/70 (39%)
GST_C_Phi 153..270 CDD:198296 24/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.