DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GSTF4

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:221 Identity:47/221 - (21%)
Similarity:80/221 - (36%) Gaps:43/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRAIMV 71
            |.|...|.||.......:.::..| :..:..|..|..:|.:||...:|...|....|:|||||..
plant    43 PFSTNTRRVLAVLHEKRLSYEPIT-VKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRAITQ 106

  Fly    72 YLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLY-----------KSFSEYYYPQIFLKKPAN- 124
            |:.         :....:...|:|.|.:..|.||.           ...|:..:.|:.  ||.. 
plant   107 YIA---------YVHSSRGTQLLNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQVI--KPIYG 160

  Fly   125 --------EENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFD----FKRY 177
                    :||...:|.........||...:.|...::|.|:..|..:..  :.|..    |::.
plant   161 LETDQTIVKENEAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNIQY--LLGTPTKKLFEKR 223

  Fly   178 ANVARWYE-----NAKKLTPGWEENW 198
            :.|.:|.:     .|.|:....|::|
plant   224 SKVRKWVDEITSREAWKMACDQEKSW 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 20/67 (30%)
PLN02473 3..196 CDD:166114 45/217 (21%)
GST_C_Delta_Epsilon 89..205 CDD:198287 27/139 (19%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 20/66 (30%)
GST_C_Phi 126..243 CDD:198296 22/120 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.