DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GSTT2

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:203 Identity:58/203 - (28%)
Similarity:93/203 - (45%) Gaps:25/203 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRAIMVYL 73
            |.|.|:||:..|...::|| :.:|:...|:|.:||:.:|||...:|.:.|....|:||.||::||
plant    11 SQPSRAVLIFCKVNEIQFD-EILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLFESHAILIYL 74

  Fly    74 VEKYGK-DDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFL---------KKPANEENY 128
            ...|.. .|..:|.|:.|:|.|:..|.:....|....|.|....:..         |..|..||.
plant    75 SSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVLAPALGLPLNPKAAAEAENI 139

  Fly   129 KKIEVAFEFLNTF-LEGQT-YSAGGDY-SLADIAFLATVSTFDVAGFDFK-------RYANVARW 183
              :..:...|.|| |:|.. :..||.. |:||::.:..:....|  .|.|       .:..|.:|
plant   140 --LTNSLSTLETFWLKGSAKFLLGGKQPSIADLSLVCELMQLQV--LDDKDRLRLLSPHKKVEQW 200

  Fly   184 YENAKKLT 191
            .|:.:|.|
plant   201 IESTRKAT 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 25/65 (38%)
PLN02473 3..196 CDD:166114 58/203 (29%)
GST_C_Delta_Epsilon 89..205 CDD:198287 29/122 (24%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 25/67 (37%)
GST_C_Theta 92..221 CDD:198292 29/121 (24%)
NAM-associated 380..>515 CDD:405060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.