DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GSTT3

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:207 Identity:59/207 - (28%)
Similarity:97/207 - (46%) Gaps:22/207 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRAIMVYL 73
            |.|.|:||:..|...::|| :.:|....|:|.:||:..|||...:|.:.|....|.||.||::||
plant    11 SQPSRAVLIFCKVNEIQFD-EILIYLANRQQLSPEFKDINPMGKVPAIVDGKLKLSESHAILIYL 74

  Fly    74 VEKY-GKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIF-------LKKPANEENYKK 130
            ...| ...|..:|.|:.|:|.|:..|.:....|....:.|....:.       |...|..|..:.
plant    75 SSAYPSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVLGPALGLPLNPKAAAEAEQL 139

  Fly   131 IEVAFEFLNTF-LEGQT-YSAGGDY-SLADIAFLATVSTFDVAGFDFK-------RYANVARWYE 185
            :..:...|:|| |:|.. :..|.:. |:||::.:..::...|  .|.|       .:.||.:|.|
plant   140 LTKSLTTLDTFWLKGNAMFLLGSNQPSIADLSLVCELTQLQV--LDDKDRLRLLSPHKNVEQWIE 202

  Fly   186 NAKKLT-PGWEE 196
            |.:|.| |.::|
plant   203 NTRKATMPHFDE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 25/65 (38%)
PLN02473 3..196 CDD:166114 58/205 (28%)
GST_C_Delta_Epsilon 89..205 CDD:198287 30/126 (24%)
GSTT3NP_198938.1 PLN02473 1..202 CDD:166114 53/193 (27%)
GST_N_Theta 3..78 CDD:239348 25/67 (37%)
GST_C_Theta 92..221 CDD:198292 30/125 (24%)
NAM-associated 378..>455 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.