DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GSTF12

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:210 Identity:55/210 - (26%)
Similarity:95/210 - (45%) Gaps:23/210 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESR 67
            ||.:..:|..:.||:.....|:||: ...|:....||..||:|...|...:|.:.|..|.|:|||
plant     5 LYGQVTAACPQRVLLCFLEKGIEFE-IIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFESR 68

  Fly    68 AIMVYLVEKYG-KDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYP---QIFLKKPANE--- 125
            ||..|...|:. :...|..|.::.:|:::|  :.|:.|.|  |:....|   .:.:|....|   
plant    69 AIARYYATKFADQGTNLLGKSLEHRAIVDQ--WADVETYY--FNVLAQPLVINLIIKPRLGEKCD 129

  Fly   126 ----ENYK-KIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLAT----VSTFDVAGFDFKRYANVA 181
                |:.| |:.|..:..|..|....:.||.::::||:..:..    :|..|:... .|...:..
plant   130 VVLVEDLKVKLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSITDINQM-VKARGSFN 193

  Fly   182 RWYENAKKLTPGWEE 196
            ||:|.... .|.|::
plant   194 RWWEEISD-RPSWKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 25/71 (35%)
PLN02473 3..196 CDD:166114 55/208 (26%)
GST_C_Delta_Epsilon 89..205 CDD:198287 27/123 (22%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 55/210 (26%)
GST_N_Phi 2..77 CDD:239351 25/72 (35%)
GST_C_Phi 91..209 CDD:198296 27/123 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.