DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GSTF2

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:178 Identity:37/178 - (20%)
Similarity:68/178 - (38%) Gaps:22/178 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAR--EQFTPEYLKINPQHTIPTLHDHGFALWE 65
            ::..|.|...|.||:......::|:   :::...:  |.....:|..||...:|...|....|:|
plant     6 VFGHPASIATRRVLIALHEKNLDFE---LVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFE 67

  Fly    66 SRAIMVYLVEKY-GKDDKLFPKDVQKQALINQRLYFDMGTLYKSF------SEYYYPQIF----- 118
            ||||..|:..:| .:...|...|.:.   |:|.....:|...:..      |:..:.|||     
plant    68 SRAITQYIAHRYENQGTNLLQTDSKN---ISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYG 129

  Fly   119 --LKKPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATV 164
              ..:....|...|:....:.....|:...|.||..::|.|:..:..:
plant   130 LTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 19/73 (26%)
PLN02473 3..196 CDD:166114 37/178 (21%)
GST_C_Delta_Epsilon 89..205 CDD:198287 15/89 (17%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 19/74 (26%)
GST_C_Phi 96..211 CDD:198296 14/82 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.