DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:216 Identity:61/216 - (28%)
Similarity:91/216 - (42%) Gaps:30/216 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65
            |.||....||....||:.......||: ...:|..|.....|.:|.:||...:|.|.|....|:|
plant     3 MKLYGDEMSACVARVLLCLHEKNTEFE-LVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFE 66

  Fly    66 SRAIMVYLVEKY-GKDDKLFPKDVQKQALINQRLYFDMGTLY--KSFSEYYYPQIFLKKPANEEN 127
            ||||..|:.||: .|...|...:..|:|.| .:|:.::...:  .:.|...:..|.:.......|
plant    67 SRAITAYIAEKHRDKGTDLTRHEDPKEAAI-VKLWSEVEAHHFNPAISAVIHQLIVVPLQGESPN 130

  Fly   128 YKKIEVAFEFLNTFLE------GQT-YSAGGDYSLADI-------AFLATVSTFDVAGFDFKRYA 178
            ...:|...|.|...|:      |:| |.||..|:|||:       .|:.|:.    ||....| .
plant   131 AAIVEENLENLGKILDVYEERLGKTKYLAGDTYTLADLHHVPYTYYFMKTIH----AGLINDR-P 190

  Fly   179 NVARWYENA------KKLTPG 193
            ||..|:|:.      .|::||
plant   191 NVKAWWEDLCSRPAFLKVSPG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 25/73 (34%)
PLN02473 3..196 CDD:166114 60/214 (28%)
GST_C_Delta_Epsilon 89..205 CDD:198287 32/127 (25%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 59/212 (28%)
GST_N_Phi 2..77 CDD:239351 25/74 (34%)
GST_C_Phi 92..208 CDD:198296 29/121 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_103768
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.