DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and AT3G47680

DIOPT Version :10

Sequence 1:NP_652713.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_190352.1 Gene:AT3G47680 / 823922 AraportID:AT3G47680 Length:302 Species:Arabidopsis thaliana


Alignment Length:61 Identity:22/61 - (36%)
Similarity:30/61 - (49%) Gaps:6/61 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 EGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYA---NVARWYENAKKLTPGWEENWAG 200
            |.:.:|||.|..|.. |:|.| |...|.|.:.|.||   .:|.:|..:.||. |.|:...|
plant    46 ERRKWSAGEDLVLVS-AWLNT-SKDAVIGNEQKGYAFWSRIAAYYGASPKLN-GVEKRETG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_652713.1 GST_N_Delta_Epsilon 1..75 CDD:239343
GST_C_Delta_Epsilon 89..205 CDD:198287 22/61 (36%)
AT3G47680NP_190352.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.