DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GDAP1L1

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:83 Identity:21/83 - (25%)
Similarity:34/83 - (40%) Gaps:12/83 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 FLKKPANE--ENYKKIEVAFEFLNTFLEGQ---TYSAGGDYSLADIAFLATVSTFDVAGFDFKRY 177
            :|||...|  ....:||...|......|||   .:..|..::|||:...||:......|.. |:|
Human   245 YLKKILGELAMVLDQIEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRLKFLGLS-KKY 308

  Fly   178 ------ANVARWYENAKK 189
                  .|:..::|..::
Human   309 WEDGSRPNLQSFFERVQR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343
PLN02473 3..196 CDD:166114 21/83 (25%)
GST_C_Delta_Epsilon 89..205 CDD:198287 21/83 (25%)
GDAP1L1NP_001243666.1 GstA 47..333 CDD:223698 21/83 (25%)
GST_N_GDAP1 47..119 CDD:239350
GST_C_GDAP1L1 220..330 CDD:198335 21/83 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154475
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.