Sequence 1: | NP_001287302.1 | Gene: | GstD10 / 59240 | FlyBaseID: | FBgn0042206 | Length: | 210 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_030107910.1 | Gene: | Clic3 / 69454 | MGIID: | 1916704 | Length: | 268 | Species: | Mus musculus |
Alignment Length: | 211 | Identity: | 45/211 - (21%) |
---|---|---|---|
Similarity: | 78/211 - (36%) | Gaps: | 52/211 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 GSAP-CRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLK-INPQHTIPTLHDHGFALWESRAIM 70
Fly 71 VYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGT----LYKSFSEYYYPQIFLKKPA-NEEN--Y 128
Fly 129 KKIEVAFEFLNTFLEG----------------QTYSAGGDYSLADIAFLATVSTFDVAGFDFKR- 176
Fly 177 -----YANVARWYENA 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD10 | NP_001287302.1 | GST_N_Delta_Epsilon | 1..75 | CDD:239343 | 18/68 (26%) |
PLN02473 | 3..196 | CDD:166114 | 45/211 (21%) | ||
GST_C_Delta_Epsilon | 89..205 | CDD:198287 | 22/128 (17%) | ||
Clic3 | XP_030107910.1 | O-ClC | 43..261 | CDD:129941 | 45/211 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844719 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |