DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and Gsto2

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_080895.2 Gene:Gsto2 / 68214 MGIID:1915464 Length:248 Species:Mus musculus


Alignment Length:207 Identity:51/207 - (24%)
Similarity:73/207 - (35%) Gaps:54/207 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPE-YLKINPQHTIPTLHDHGFAL-WESRAI 69
            |.|...|.||   ||.|:..:   :||...:.:  |: |...:|...||.|.:....| :||...
Mouse    33 PYSHRARLVL---KAKGIRHE---VININLKSK--PDWYYTKHPFGQIPVLENSQCQLVYESVIA 89

  Fly    70 MVYLVEKY-GKDDKLFPKD-------------------VQKQALINQRLYFDMGTLYKSFSEYYY 114
            ..||.:.| |:  ||||.|                   :.|:.||..|...|...|         
Mouse    90 CEYLDDVYPGR--KLFPYDPYERARQKMLLELFCKVPPLSKECLIALRCGRDCTDL--------- 143

  Fly   115 PQIFLKKPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGF-DFKRYA 178
                  |.|..:....:|...|:.||     |:..|...|:.|..........||.|. |...:.
Mouse   144 ------KVALRQELCNMEEILEYQNT-----TFFGGDCISMIDYLVWPWFERLDVYGLADCVNHT 197

  Fly   179 NVAR-WYENAKK 189
            .:.| |..:.|:
Mouse   198 PMLRLWIASMKQ 209

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 21/69 (30%)
PLN02473 3..196 CDD:166114 51/207 (25%)
GST_C_Delta_Epsilon 89..205 CDD:198287 23/103 (22%)
Gsto2NP_080895.2 GST_N_Omega 6..94 CDD:239353 20/68 (29%)