DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and Eef1g

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_080283.3 Gene:Eef1g / 67160 MGIID:1914410 Length:437 Species:Mus musculus


Alignment Length:151 Identity:38/151 - (25%)
Similarity:70/151 - (46%) Gaps:12/151 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TPEYLKINPQHTIPTLH-DHGFALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGT 104
            |||:|:..|...:|... |.||.::||.||..|:     .:::|.....:..|.:.|.:.|....
Mouse    46 TPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYV-----SNEELRGSTPEAAAQVVQWVSFADSD 105

  Fly   105 LYKSFSEYYYPQIFL---KKPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVST 166
            :....|.:.:|.:.:   .|.|.|...::::.....|:|.|:.:|:..|...:||||..:.|:..
Mouse   106 IVPPASTWVFPTLGIMHHNKQATENAKEEVKRILGLLDTHLKTRTFLVGERVTLADITVVCTLLW 170

  Fly   167 F--DVAGFDFKR-YANVARWY 184
            .  .|....|:: :.|..||:
Mouse   171 LYKQVLEPSFRQAFPNTNRWF 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 14/34 (41%)
PLN02473 3..196 CDD:166114 38/151 (25%)
GST_C_Delta_Epsilon 89..205 CDD:198287 23/102 (23%)
Eef1gNP_080283.3 GST_N_EF1Bgamma 4..82 CDD:239342 14/40 (35%)
GstA 5..202 CDD:223698 38/151 (25%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 23/101 (23%)
FinO_conjug_rep <211..>265 CDD:301594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268
EF1G 275..381 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.