DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GSTT2B

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001074312.1 Gene:GSTT2B / 653689 HGNCID:33437 Length:244 Species:Homo sapiens


Alignment Length:215 Identity:59/215 - (27%)
Similarity:104/215 - (48%) Gaps:21/215 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65
            ::|:....|.|.|:|.:.||..|:..:.:|:...:.:.: :.|:|:||....:|||.|..|.|.|
Human     3 LELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHK-SKEFLQINSLGKLPTLKDGDFILTE 66

  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFS-----EYYYPQIFLKKPAN- 124
            |.||::||..||...|..:|.|:|.:|.:::.|.:....:..:|.     :...|.|.::.|.. 
Human    67 SSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEK 131

  Fly   125 -EENYKKIEVAFEFL-NTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFD-FKRYANVARWYEN 186
             |.|...::.|.::| :.||..:.:.||...:|||:..|..:......|:: |:....:|.|   
Human   132 VERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAW--- 193

  Fly   187 AKKLTPGWEENWAG---CQE 203
                 .|..|.:.|   |||
Human   194 -----RGRVEAFLGAELCQE 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 25/73 (34%)
PLN02473 3..196 CDD:166114 54/201 (27%)
GST_C_Delta_Epsilon 89..205 CDD:198287 29/127 (23%)
GSTT2BNP_001074312.1 GST_N_Theta 3..78 CDD:239348 25/75 (33%)