Sequence 1: | NP_001287302.1 | Gene: | GstD10 / 59240 | FlyBaseID: | FBgn0042206 | Length: | 210 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001038525.1 | Gene: | gstr / 564619 | ZFINID: | ZDB-GENE-090507-1 | Length: | 226 | Species: | Danio rerio |
Alignment Length: | 209 | Identity: | 47/209 - (22%) |
---|---|---|---|
Similarity: | 92/209 - (44%) | Gaps: | 11/209 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65
Fly 66 SRAIMVYLVEKY-GKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYY----PQIFLKKPANE 125
Fly 126 ENYKKIEVAFEFLNTFLEGQ---TYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENA 187
Fly 188 K---KLTPGWEENW 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD10 | NP_001287302.1 | GST_N_Delta_Epsilon | 1..75 | CDD:239343 | 20/73 (27%) |
PLN02473 | 3..196 | CDD:166114 | 45/203 (22%) | ||
GST_C_Delta_Epsilon | 89..205 | CDD:198287 | 25/120 (21%) | ||
gstr | NP_001038525.1 | GstA | 5..207 | CDD:223698 | 45/201 (22%) |
GST_N_family | 5..78 | CDD:238319 | 19/72 (26%) | ||
GST_C_family | 99..199 | CDD:198286 | 20/99 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589676 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000035 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.850 |