DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and gstr

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001038525.1 Gene:gstr / 564619 ZFINID:ZDB-GENE-090507-1 Length:226 Species:Danio rerio


Alignment Length:209 Identity:47/209 - (22%)
Similarity:92/209 - (44%) Gaps:11/209 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65
            |.||:..||.||..:::..:...::..|..:::...:|..:||...:||:..:||.......:.|
Zfish     5 MLLYWGTGSPPCWRLMIALEEKQLQGYKHKLLSFDKKEHQSPEVKALNPRAQLPTFKHGEIVVNE 69

  Fly    66 SRAIMVYLVEKY-GKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYY----PQIFLKKPANE 125
            |.|..:||...: .:..:|.|.:..:.||:.||::.......|.:...:|    |:....:.|.:
Zfish    70 SFAACLYLESVFKSQGTRLIPDNPAEMALVYQRMFETENLQQKMYEVAFYDWLVPEGERLESALK 134

  Fly   126 ENYKKIEVAFEFLNTFLEGQ---TYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENA 187
            .|.:|:....:....:||..   :|.||.::|:||:.....::.|.......:|...:..:||..
Zfish   135 RNKEKLIEELKLWEGYLEKMGKGSYLAGKNFSMADVVCFPVIAYFPRLQCPKERCPRLMEYYEMV 199

  Fly   188 K---KLTPGWEENW 198
            |   .:...|...|
Zfish   200 KDRPSIKASWPPEW 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 20/73 (27%)
PLN02473 3..196 CDD:166114 45/203 (22%)
GST_C_Delta_Epsilon 89..205 CDD:198287 25/120 (21%)
gstrNP_001038525.1 GstA 5..207 CDD:223698 45/201 (22%)
GST_N_family 5..78 CDD:238319 19/72 (26%)
GST_C_family 99..199 CDD:198286 20/99 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589676
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.