DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and gdap1l1

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:263 Identity:45/263 - (17%)
Similarity:84/263 - (31%) Gaps:81/263 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESR 67
            ||:...|...:.|.:.....|:..:::. ::....||..|.::::|....:|........:.:..
Zfish    50 LYHWTQSFSSQKVRLVINEKGLLCEERD-VSLPLTEQKEPWFMRLNLGEEVPVFIHGDTIVSDYN 113

  Fly    68 AIMVYL-----------------------VEKYGK---------------------DDKLFPKDV 88
            .|:.|:                       |::|.:                     .|.:.||  
Zfish   114 QIIDYIETNFVGDTVAQLIPDEGTPMYARVQQYRELLDGLPMDAYTHGCILHPELTTDSMIPK-- 176

  Fly    89 QKQALINQRLYFDMGTLYKSFSEYYYPQI---FLKKPA---------NEENYKK----------- 130
            ...|.|.:.|......|.|  .::..||:   :|.|..         :..||.|           
Zfish   177 YATAEIRRHLANAASELMK--LDHEEPQLTEPYLSKQKKLMAKILDHDNVNYLKKILGELAMVLD 239

  Fly   131 -IEVAFEFLNTFLEGQ---TYSAGGDYSLADIAFLATVSTFDVAGFDFKRY-----ANVARWYEN 186
             :|...|......:||   .:..|..::||||...||:......|...|.:     .|:..::|.
Zfish   240 QVEAELEKRKLEYQGQKCELWLCGPTFTLADICLGATLHRLKFLGLSRKYWEDGSRPNLQSFFER 304

  Fly   187 AKK 189
            .:|
Zfish   305 VQK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 12/94 (13%)
PLN02473 3..196 CDD:166114 45/263 (17%)
GST_C_Delta_Epsilon 89..205 CDD:198287 28/133 (21%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 45/263 (17%)
Thioredoxin_like 48..120 CDD:294274 12/70 (17%)
GST_C_GDAP1L1 201..311 CDD:198335 23/107 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589626
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.