Sequence 1: | NP_001287302.1 | Gene: | GstD10 / 59240 | FlyBaseID: | FBgn0042206 | Length: | 210 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_687373.1 | Gene: | gdap1l1 / 562163 | ZFINID: | ZDB-GENE-080812-2 | Length: | 367 | Species: | Danio rerio |
Alignment Length: | 263 | Identity: | 45/263 - (17%) |
---|---|---|---|
Similarity: | 84/263 - (31%) | Gaps: | 81/263 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 LYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESR 67
Fly 68 AIMVYL-----------------------VEKYGK---------------------DDKLFPKDV 88
Fly 89 QKQALINQRLYFDMGTLYKSFSEYYYPQI---FLKKPA---------NEENYKK----------- 130
Fly 131 -IEVAFEFLNTFLEGQ---TYSAGGDYSLADIAFLATVSTFDVAGFDFKRY-----ANVARWYEN 186
Fly 187 AKK 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD10 | NP_001287302.1 | GST_N_Delta_Epsilon | 1..75 | CDD:239343 | 12/94 (13%) |
PLN02473 | 3..196 | CDD:166114 | 45/263 (17%) | ||
GST_C_Delta_Epsilon | 89..205 | CDD:198287 | 28/133 (21%) | ||
gdap1l1 | XP_687373.1 | GstA | 48..314 | CDD:223698 | 45/263 (17%) |
Thioredoxin_like | 48..120 | CDD:294274 | 12/70 (17%) | ||
GST_C_GDAP1L1 | 201..311 | CDD:198335 | 23/107 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589626 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |