DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and gdap1

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:275 Identity:47/275 - (17%)
Similarity:85/275 - (30%) Gaps:112/275 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYYRPGSAPCRSVLMTAKALGV---EFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALW 64
            ||:...|...:.|.:.....|:   ::|    ::....|...|.::::||...:|.|......:.
Zfish    42 LYHWTQSFSSQKVRLAIAEKGLQCEDYD----VSLPLSEHNEPWFMRLNPTGEVPVLVHDNHVIC 102

  Fly    65 ESRAIMVYLVEKYGKDD--KLFPKDVQKQALINQRLYFDMGTLYKSFSEYY-------------- 113
            :...||.||.:.:..:.  ||.|::               |:.|....::|              
Zfish   103 DPTQIMDYLEQNFCDEQTPKLIPEE---------------GSTYYHRVQHYRELLDSLQMDAYTH 152

  Fly   114 ----YPQIF-----------------------LKKPANE----------------------ENYK 129
                :|:|.                       |||.|.|                      :|.|
Zfish   153 GCILHPEITVDSHIPAYATTHIRTQIGNTESELKKLAVENPDLKDAYIAKQRRLKSKLFDHDNMK 217

  Fly   130 KIEVAFEFLNTFL----------------EG--QTYSAGGDYSLADIAFLATVSTFDVAGFDFKR 176
            .::...:.|...|                ||  |.:..|..:|:||::...|:......|.. :|
Zfish   218 YLKKLLDELENVLDQVETELQRRSEETPEEGSQQAWLCGDFFSIADVSLAVTLHRLKFLGLS-RR 281

  Fly   177 Y------ANVARWYE 185
            |      .|:..:||
Zfish   282 YWGNGMRVNLETYYE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 16/74 (22%)
PLN02473 3..196 CDD:166114 47/275 (17%)
GST_C_Delta_Epsilon 89..205 CDD:198287 28/184 (15%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 47/275 (17%)
GST_N_GDAP1 40..112 CDD:239350 15/73 (21%)
GST_C_family 193..304 CDD:295467 18/105 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589666
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.