Sequence 1: | NP_001287302.1 | Gene: | GstD10 / 59240 | FlyBaseID: | FBgn0042206 | Length: | 210 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061845.2 | Gene: | GDAP1 / 54332 | HGNCID: | 15968 | Length: | 358 | Species: | Homo sapiens |
Alignment Length: | 261 | Identity: | 49/261 - (18%) |
---|---|---|---|
Similarity: | 86/261 - (32%) | Gaps: | 77/261 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 LYYRPGSAPCRSV--LMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65
Fly 66 SRAIMVYLVEKY----------GKDDKLFPK----------------------------DVQKQA 92
Fly 93 LINQRLYFDMGTL---YKSFSE--------YYYPQIFLK-KPANEENYKKIEVAFEFLNTFL--- 142
Fly 143 -------------EG-QTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVAR-----WYENAK 188
Fly 189 K 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD10 | NP_001287302.1 | GST_N_Delta_Epsilon | 1..75 | CDD:239343 | 17/73 (23%) |
PLN02473 | 3..196 | CDD:166114 | 49/261 (19%) | ||
GST_C_Delta_Epsilon | 89..205 | CDD:198287 | 29/135 (21%) | ||
GDAP1 | NP_061845.2 | GST_N_GDAP1 | 26..98 | CDD:239350 | 16/72 (22%) |
GST_C_GDAP1 | 179..289 | CDD:198336 | 24/107 (22%) | ||
Required for mitochondrial localization | 320..358 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154505 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |