DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and CLIC5

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001107558.1 Gene:CLIC5 / 53405 HGNCID:13517 Length:410 Species:Homo sapiens


Alignment Length:202 Identity:44/202 - (21%)
Similarity:67/202 - (33%) Gaps:68/202 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PGSAPCRSVLMTAKALGVEFDKKTIIN---TRAREQFTPE-YLKINPQHTIPTLHDHGFALWESR 67
            ||:.|        ..|....|.||.:|   ....|..||| |.|:..:|.            ||.
Human   227 PGTHP--------PFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHR------------ESN 271

  Fly    68 AIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYKKIE 132
            ...:.:..|:    ..:.|:.::|.  |..|...:....|...:|      |..|..||    |:
Human   272 TAGIDIFSKF----SAYIKNTKQQN--NAALERGLTKALKKLDDY------LNTPLPEE----ID 320

  Fly   133 VAFEFLNT----------FLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENA 187
            .     ||          ||:|.      :.:|||...|..:....:..   |:|.|    |:..
Human   321 A-----NTCGEDKGSRRKFLDGD------ELTLADCNLLPKLHVVKIVA---KKYRN----YDIP 367

  Fly   188 KKLTPGW 194
            .::|..|
Human   368 AEMTGLW 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 17/71 (24%)
PLN02473 3..196 CDD:166114 44/202 (22%)
GST_C_Delta_Epsilon 89..205 CDD:198287 25/116 (22%)
CLIC5NP_001107558.1 O-ClC 173..408 CDD:129941 44/202 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.