DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:196 Identity:55/196 - (28%)
Similarity:94/196 - (47%) Gaps:16/196 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65
            :.||....|.|||||.:.|||..:.|:...:...:|.|..|.|:.|::..|.:|.|.|..|.:.|
 Frog     6 LTLYLDLLSQPCRSVYIFAKANRIPFNYCKLQLLKAGEHLTQEFGKVSVLHKVPALKDGNFTMAE 70

  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYY-----PQIFLKKPANE 125
            |.|:::||..||...:..:|.|:||:|.:::.|.:.........|:.::     |.|..|:..:|
 Frog    71 STAMLLYLARKYKTPNHWYPSDLQKRARVDEYLAWQHTNTRPHGSKVFWTKCVSPTILGKEVPSE 135

  Fly   126 ENYKKIEVAFEFLNT-------FLEGQTYSAGGDYSLADIAFLATVSTFDVAGFD-FKRYANVAR 182
               |...|..||:.|       ||..:.:.||.:.|:||:..:..:.....:|.: |:....:..
 Frog   136 ---KMNAVMAEFVTTMNNFEEKFLGNKPFIAGDEISVADLVAIVEIMQVIASGVNVFEERPKLGS 197

  Fly   183 W 183
            |
 Frog   198 W 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 27/73 (37%)
PLN02473 3..196 CDD:166114 55/194 (28%)
GST_C_Delta_Epsilon 89..205 CDD:198287 24/108 (22%)
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 27/75 (36%)
GST_C_Theta 95..221 CDD:198292 23/107 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.