DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and clic5a

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:229 Identity:49/229 - (21%)
Similarity:77/229 - (33%) Gaps:65/229 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYYRPGS-----APC---RSVLMTAKALGVEFDKKTIINTRAREQFTPEYL-KINPQHTIPTL 56
            ::|:.:.||     ..|   :.:.|.....||.|:..|:...|     .|..| .:.|....|.|
Zfish    12 IELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKR-----KPADLHNLAPGTPPPFL 71

  Fly    57 HDHGFALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKK 121
            ..:|....:...|..:|      ::.|.|....|.|..|:........::..||.|      :|.
Zfish    72 TFNGEVRTDVNKIEEFL------EEMLAPPKYPKLAAKNKESNTAGNDIFAKFSAY------IKN 124

  Fly   122 PANEEN----------YKKIEVAFEFLNTFL--------------EGQTYSAGGDYSLADIAFLA 162
            ...|.|          .||::   .|||:.|              ..:.|..|.:.:|||...|.
Zfish   125 TKPEANASLEKGLLKVLKKLD---SFLNSPLPDEIDAESTGEEKSSNRKYLDGNELTLADCNLLP 186

  Fly   163 TVSTFDVAGFDFKRYAN---------VARWYENA 187
            .:....|..   |:|.|         |.|:.:||
Zfish   187 KLHVVKVVS---KKYRNFEIPSDLSGVWRYLQNA 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 18/82 (22%)
PLN02473 3..196 CDD:166114 49/227 (22%)
GST_C_Delta_Epsilon 89..205 CDD:198287 29/132 (22%)
clic5aNP_001007386.1 GST_N_CLIC 8..97 CDD:239359 20/95 (21%)
O-ClC 10..244 CDD:129941 49/229 (21%)
GST_C_CLIC5 104..244 CDD:198330 27/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589650
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.