DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and gstt1

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001006811.1 Gene:gstt1 / 448525 XenbaseID:XB-GENE-998695 Length:242 Species:Xenopus tropicalis


Alignment Length:223 Identity:57/223 - (25%)
Similarity:95/223 - (42%) Gaps:38/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAR----EQFTPEYLKINPQHTIPTLHDHGF 61
            :.||....|.|||||.:.|||..:.|:     |.:.|    |..|.||.|:|....:|.|.|..|
 Frog     4 LTLYLDLLSQPCRSVYIFAKANNIPFN-----NHQVRLFKGEHLTEEYGKVNVLRKVPALKDCDF 63

  Fly    62 ALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQ----IFLKKP 122
            .:.||.|:::|:..|:...|..:|.|:||.|.:::.|.:.......:.|:.::.:    :.|.:.
 Frog    64 FMAESTAMLLYMARKFKTADHWYPSDIQKCAKVDEYLAWQHTNTRPNGSKVFWVKCLTPLILGQE 128

  Fly   123 ANEENYKKIEVAF-----EFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFD-FKRYANVA 181
            |..|....:...|     .|...||..:.:.||.:.|:||:..:..:......|.: |.....:|
 Frog   129 APAEKVDAVVAEFNTTMNNFEEKFLGNKLFIAGDEISVADLVAIVEIMQVVAGGINVFDDRPKLA 193

  Fly   182 RWYE-------------------NAKKL 190
            .|.:                   ||||:
 Frog   194 AWKKRVVEALGEELFLEAHEGILNAKKM 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 28/77 (36%)
PLN02473 3..196 CDD:166114 57/221 (26%)
GST_C_Delta_Epsilon 89..205 CDD:198287 25/131 (19%)
gstt1NP_001006811.1 GST_N_Theta 4..79 CDD:239348 28/79 (35%)
GST_C_Theta 92..217 CDD:198292 20/124 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.