DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and eEF1gamma

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:193 Identity:45/193 - (23%)
Similarity:77/193 - (39%) Gaps:22/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRARE-QFTPEYLKINPQHTIPTLHD-HGFALWE 65
            ||..|.:......|:.|:..|.:.  |...|.:..| ..:.|:||..|...:|.... .|..|.|
  Fly     6 LYTYPENFRAYKALIAAQYSGAQV--KVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSE 68

  Fly    66 SRAIMVYLVEKYGKDDKL-FPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQI-FLKKPANEENY 128
            |.||...|..:..:..|. |     .||.:.|.:.|....:..:...:.:|.: .|.:..|....
  Fly    69 SNAIAYLLANEQLRGGKCPF-----VQAQVQQWISFADNEIVPASCAWVFPLLGILPQQKNSTAK 128

  Fly   129 KKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDF-------KRYANVARWY 184
            ::.|...:.||..|:..|:.||...:||||...:::...    :::       ..:.||.||:
  Fly   129 QEAEAVLQQLNQKLQDATFLAGERITLADIVVFSSLLHL----YEYVLEPSVRSAFGNVNRWF 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 21/73 (29%)
PLN02473 3..196 CDD:166114 45/193 (23%)
GST_C_Delta_Epsilon 89..205 CDD:198287 22/104 (21%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 21/74 (28%)
GstA 5..187 CDD:223698 44/191 (23%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 22/102 (22%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459940
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.