DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and gsto1

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:225 Identity:50/225 - (22%)
Similarity:81/225 - (36%) Gaps:70/225 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PGSAP--------------CRSVLMTAKALGVEFDKKTI-INTRAREQFTPEYLKINPQHTIPTL 56
            ||..|              .:...:...|.|:::|  || ||.:.:..:   :|:.||...:|.|
Zfish    15 PGPVPKDHIRLYSMRFCPFAQRTRLVLNAKGIKYD--TININLKNKPDW---FLEKNPLGLVPVL 74

  Fly    57 H-DHGFALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLK 120
            . ..|..::||.....||.|.| .:.||.|.|..::|  .||:..:   |:...:.|:|     |
Zfish    75 ETQSGQVIYESPITCEYLDEVY-PEKKLLPFDPFERA--QQRMLLE---LFSKVTPYFY-----K 128

  Fly   121 KPANE---ENYKKIEVAF-----EFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRY 177
            .|.|.   |:...:|...     :|....|:.::...|||               .:...|:..:
Zfish   129 IPVNRTKGEDVSALETELKDKLSQFNEILLKKKSKFFGGD---------------SITMIDYMMW 178

  Fly   178 ANVARWYE-----NAKKLTPG------WEE 196
            .    |:|     |.|....|      |.|
Zfish   179 P----WFERLETMNLKHCLDGTPELKKWTE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 20/83 (24%)
PLN02473 3..196 CDD:166114 49/223 (22%)
GST_C_Delta_Epsilon 89..205 CDD:198287 24/127 (19%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 19/82 (23%)
GstA 25..210 CDD:223698 47/215 (22%)
GST_C_Omega 107..229 CDD:198293 24/127 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589462
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.