DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GstD9

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:210 Identity:123/210 - (58%)
Similarity:162/210 - (77%) Gaps:3/210 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65
            :|.||...||||||:||||:|||:|.:||. ::..|.|...||::|||||||||||.|.|||:||
  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQ-VDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWE 65

  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIF--LKKPANEENY 128
            ||||::||.|||.||..|:|||.|::|:|||||:||:.|||:|:..|||||:|  :||||:.:|.
  Fly    66 SRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNL 130

  Fly   129 KKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLTPG 193
            |||:.||...||.|:||.|:|....:|||.|.|||||||:::.:||.:|..|.|||:||||:.||
  Fly   131 KKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNAKKVIPG 195

  Fly   194 WEENWAGCQEFRKYF 208
            |||||.||:.::|.:
  Fly   196 WEENWEGCEYYKKLY 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 46/73 (63%)
PLN02473 3..196 CDD:166114 115/194 (59%)
GST_C_Delta_Epsilon 89..205 CDD:198287 67/117 (57%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 46/73 (63%)
GstA 4..187 CDD:223698 107/183 (58%)
GST_C_Delta_Epsilon 89..207 CDD:198287 67/117 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468460
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_103768
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.