DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and clic5b

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_998062.1 Gene:clic5b / 405833 ZFINID:ZDB-GENE-040426-2542 Length:408 Species:Danio rerio


Alignment Length:205 Identity:48/205 - (23%)
Similarity:70/205 - (34%) Gaps:55/205 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PGSAPCRSVLMTAKALGVEFDKKTIINTRAREQF------TPEYLKINPQHTIPTLHDHGFALWE 65
            ||:.|        ..|....:.||.:|  ..|:|      .|:|.|:..:|.            |
Zfish   226 PGTHP--------PFLTFNGEVKTDVN--KIEEFLEEVLAPPKYPKLAARHR------------E 268

  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEE-NYK 129
            |.|....:..|:    ..|.|:.:..|  |:.|...:....|...||      |..|..:| :..
Zfish   269 SNAAGNDIFAKF----SAFIKNTKPDA--NEALEKGLTKALKKLDEY------LNSPLPDEVDAD 321

  Fly   130 KIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLTPGW 194
            .:|........||:      |.|.:|||...|..:....|..   |:|.|    ::....||..|
Zfish   322 SMEEEKASNRRFLD------GNDLTLADCNLLPKLHIVKVVA---KKYRN----FDIPSDLTGVW 373

  Fly   195 EE-NWAGCQE 203
            .. |.|..||
Zfish   374 RYLNSAYAQE 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 16/73 (22%)
PLN02473 3..196 CDD:166114 44/195 (23%)
GST_C_Delta_Epsilon 89..205 CDD:198287 29/117 (25%)
clic5bNP_998062.1 GST_N_CLIC 170..259 CDD:239359 10/42 (24%)
O-ClC 172..407 CDD:129941 48/205 (23%)
GST_C_CLIC5 266..406 CDD:198330 36/155 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589651
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.