Sequence 1: | NP_001287302.1 | Gene: | GstD10 / 59240 | FlyBaseID: | FBgn0042206 | Length: | 210 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998062.1 | Gene: | clic5b / 405833 | ZFINID: | ZDB-GENE-040426-2542 | Length: | 408 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 48/205 - (23%) |
---|---|---|---|
Similarity: | 70/205 - (34%) | Gaps: | 55/205 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 PGSAPCRSVLMTAKALGVEFDKKTIINTRAREQF------TPEYLKINPQHTIPTLHDHGFALWE 65
Fly 66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEE-NYK 129
Fly 130 KIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLTPGW 194
Fly 195 EE-NWAGCQE 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD10 | NP_001287302.1 | GST_N_Delta_Epsilon | 1..75 | CDD:239343 | 16/73 (22%) |
PLN02473 | 3..196 | CDD:166114 | 44/195 (23%) | ||
GST_C_Delta_Epsilon | 89..205 | CDD:198287 | 29/117 (25%) | ||
clic5b | NP_998062.1 | GST_N_CLIC | 170..259 | CDD:239359 | 10/42 (24%) |
O-ClC | 172..407 | CDD:129941 | 48/205 (23%) | ||
GST_C_CLIC5 | 266..406 | CDD:198330 | 36/155 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589651 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |