DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and gstt2

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_956815.2 Gene:gstt2 / 393493 ZFINID:ZDB-GENE-040426-1617 Length:228 Species:Danio rerio


Alignment Length:163 Identity:55/163 - (33%)
Similarity:82/163 - (50%) Gaps:18/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRAIMVYL 73
            |.|||:||:..|...:....:.|. .|..||.|||:.|:||...:|.|.|:||.|.||.||:.||
Zfish    15 SQPCRAVLIFLKHNKIPHTVEQIA-IRKGEQKTPEFTKLNPMQKVPVLEDNGFVLTESDAILKYL 78

  Fly    74 VEKYGKDDKLFPKDVQKQALINQ-RLYFDMGTLYKSFSEYYYPQIFLK----KPANEENYKKIEV 133
            ...|...|..:||..:|:|.::: ..:..|.|...: :..::.::.|.    :|||.   .|:|.
Zfish    79 ATTYKVPDHWYPKLPEKRARVDEYTAWHHMNTRMHA-ATVFWQEVLLPLMTGQPANT---AKLEK 139

  Fly   134 AFEFL--------NTFLEGQTYSAGGDYSLADI 158
            |...|        |.||:.|.:..|.|.||||:
Zfish   140 ALSDLSGTLDKLENMFLKRQAFLCGDDISLADL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 29/65 (45%)
PLN02473 3..196 CDD:166114 55/163 (34%)
GST_C_Delta_Epsilon 89..205 CDD:198287 22/83 (27%)
gstt2NP_956815.2 GST_N_Theta 7..82 CDD:239348 29/67 (43%)
GST_C_Theta 95..220 CDD:198292 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589530
Domainoid 1 1.000 50 1.000 Domainoid score I11638
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.