DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GstO1

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:180 Identity:44/180 - (24%)
Similarity:70/180 - (38%) Gaps:36/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DKKTI------INTRAREQFTPEYLKINPQHT-IPTLH---DHGF-ALWESRAIMVYLVEKYGKD 80
            |.|.|      ||.|.:    ||:..:....| :|.|.   :.|. .|.||..|..||.||| .:
  Fly    41 DAKKIPYHAIYINLRDK----PEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKY-PE 100

  Fly    81 DKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKP---ANEENYKKIEVAFEFLNTFL 142
            ..|:|||:.|:|  .:::..:.   :..|...:|..:....|   .:.::|..:.|..|.|.   
  Fly   101 VPLYPKDLLKKA--QEKILIER---FGQFINAFYYLLLHDNPEQLVDTDHYAGLVVYEEELK--- 157

  Fly   143 EGQTYSAGGDY-SLADIAFLATVSTFDVAGFDF--------KRYANVARW 183
            ...|...|||. .:.|.........||...:.|        :|:..:.:|
  Fly   158 RRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFELSPERFPTLIKW 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 18/58 (31%)
PLN02473 3..196 CDD:166114 44/180 (24%)
GST_C_Delta_Epsilon 89..205 CDD:198287 19/107 (18%)
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 17/57 (30%)
GstA 22..216 CDD:223698 44/180 (24%)
GST_C_Omega 109..234 CDD:198293 19/107 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.