DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and se

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:173 Identity:39/173 - (22%)
Similarity:57/173 - (32%) Gaps:76/173 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PEY-LKINPQHTIPTL---HDHG-FALWESRAIMVYLVEKYGKDDKLFPKD----VQKQALINQR 97
            ||: |:.|||..:|.|   .:.| ..|.||..|..||.|:|.. ..|:|:|    ||.:.|| :|
  Fly    58 PEWLLEKNPQGKVPALEIVREPGPPVLTESLLICEYLDEQYPL-RPLYPRDPLKKVQDKLLI-ER 120

  Fly    98 LYFDMGTLYK------------------------------------------------------- 107
            ....:|..:|                                                       
  Fly   121 FRAVLGAFFKASDGGDLEPFWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQR 185

  Fly   108 ----SFSEYYYPQIFL------KKPANEENYKKIEVAFEFLNT 140
                ::.:..:||:.|      :.||....|.:.||..|||.|
  Fly   186 GEDYNYDQSRFPQLTLWLERMKRDPAVMAFYMEAEVQAEFLRT 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 15/37 (41%)
PLN02473 3..196 CDD:166114 39/173 (23%)
GST_C_Delta_Epsilon 89..205 CDD:198287 18/117 (15%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 14/36 (39%)
GstA 22..215 CDD:223698 32/158 (20%)
GST_C_Omega 109..229 CDD:198293 19/121 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.