DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GstE12

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster


Alignment Length:209 Identity:78/209 - (37%)
Similarity:116/209 - (55%) Gaps:4/209 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESR 67
            |||...|.|.|:||:||||:|::.:.:. ||....|..|||:||:|||||||||.|....:.:|.
  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRP-INLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSH 69

  Fly    68 AIMVYLVEKYG-KDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFL-KKPANEENYKK 130
            ||..||||||| |:.:|:||::.::|.::.||:.|.|.|:......|.|.::. ....:.:....
  Fly    70 AICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSIDKIAY 134

  Fly   131 IEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATV-STFDVAGFDFKRYANVARWYENAKKLTPGW 194
            |:..:|.|..||:.|.|..|.|.::||...:||| |..|.|..|..::..:..|.:...:|....
  Fly   135 IQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRLAELPYYQ 199

  Fly   195 EENWAGCQEFRKYF 208
            |.|..|..|.:..|
  Fly   200 EVNGDGADELKSIF 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 36/71 (51%)
PLN02473 3..196 CDD:166114 73/195 (37%)
GST_C_Delta_Epsilon 89..205 CDD:198287 32/117 (27%)
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 36/71 (51%)
GstA 6..201 CDD:223698 73/195 (37%)
GST_C_Delta_Epsilon 92..210 CDD:198287 32/117 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460286
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.