DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GstE7

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster


Alignment Length:209 Identity:82/209 - (39%)
Similarity:125/209 - (59%) Gaps:6/209 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESR 67
            ||....|.|.|:|.:|..||.|.:: ...:||||:|.|:.|:||.|||||:|||.|.|..:|:|.
  Fly     6 LYGLEASPPVRAVKLTLAALEVPYE-FVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSH 69

  Fly    68 AIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPA--NEENYKK 130
            ||:.|||.||||.|.|:|||:.::|:::|||:|:.|.::.:........:|..|..  .:|.|..
  Fly    70 AIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPKERYDA 134

  Fly   131 IEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDV-AGFDFKRYANVARWYENAKKLTPGW 194
            |...::||..||.|..|.||...::||.:.::|||:.:| ...|..:|..:|.|::..:|| |.:
  Fly   135 IIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRLQKL-PYY 198

  Fly   195 EE-NWAGCQEFRKY 207
            || |..|.:.|..:
  Fly   199 EEANGNGARTFESF 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 35/71 (49%)
PLN02473 3..196 CDD:166114 77/195 (39%)
GST_C_Delta_Epsilon 89..205 CDD:198287 36/119 (30%)
GstE7NP_611329.1 GstA 4..196 CDD:223698 76/191 (40%)
GST_N_Delta_Epsilon 4..77 CDD:239343 35/71 (49%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/118 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460282
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.