DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GstE6

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster


Alignment Length:216 Identity:78/216 - (36%)
Similarity:126/216 - (58%) Gaps:14/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65
            :.||....|.|.|:|.:|..||.:.::... ::..||.|.:||||:.|||||:|||.|.|..:|:
  Fly     4 LTLYGLDPSPPVRAVKLTLAALNLTYEYVN-VDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWD 67

  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLY----KSFSEYYYPQIFLKKPANEE 126
            |.||:.|||.||...|.|:|||..|:|:::|||:|:.|.::    :|.|:....|...|.|  :|
  Fly    68 SHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVP--KE 130

  Fly   127 NYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDV-AGFDFKRYANVARWYENAKKL 190
            .|..|...::|:.|||:||.|.||...::||.:.:::|::.:. ...|..:|..:..|.:..::|
  Fly   131 RYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQL 195

  Fly   191 TPGWEE-NWAGCQE----FRK 206
             |.:|| |..|.::    |:|
  Fly   196 -PYYEEANGKGVRQLVAIFKK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 32/73 (44%)
PLN02473 3..196 CDD:166114 72/197 (37%)
GST_C_Delta_Epsilon 89..205 CDD:198287 36/125 (29%)
GstE6NP_611328.1 GstA 4..196 CDD:223698 71/195 (36%)
GST_N_Delta_Epsilon 4..77 CDD:239343 32/73 (44%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/120 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460285
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.