DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GstE4

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:208 Identity:72/208 - (34%)
Similarity:118/208 - (56%) Gaps:6/208 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65
            :.||....|.|.|:.|:|.|||.:.|: ...:|...:|.|:.::.|.|||||:|.|.|....:|:
  Fly     4 ISLYGLDASPPTRACLLTLKALDLPFE-FVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWD 67

  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKS-FSEYYYPQIFLKKPANEEN-Y 128
            |.|||.||||||...|:|:|||:.::|.::|.::|:.|.:::| ......|.:|..:|....| .
  Fly    68 SHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPRNQV 132

  Fly   129 KKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDV-AGFDFKRYANVARWYENAKKLTP 192
            ..|...::|:.|||:...:.||...::||.:.::|:::..| ...|..:|..:|.|.|..|:| |
  Fly   133 DHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKEL-P 196

  Fly   193 GWEE-NWAGCQEF 204
            .:|| |..|..:|
  Fly   197 YYEEANGKGAAQF 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 30/73 (41%)
PLN02473 3..196 CDD:166114 67/195 (34%)
GST_C_Delta_Epsilon 89..205 CDD:198287 33/120 (28%)
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 30/73 (41%)
GstA 6..196 CDD:223698 66/191 (35%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/118 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460277
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.