DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GstE1

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster


Alignment Length:205 Identity:77/205 - (37%)
Similarity:111/205 - (54%) Gaps:8/205 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YRPGSAPC-RSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRA 68
            |....:|| |:|.:|.|.|.::::.|. :|.:|.|..:.||:|.|||||:|.|.|:|..:|:|.|
  Fly     9 YGTDLSPCVRTVKLTLKVLNLDYEYKE-VNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHA 72

  Fly    69 IMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYKKIEV 133
            |..|||:||.|.|:|:|||:.|:|::||||:||...:|.|.:....|  |......|...:|::.
  Fly    73 IAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRP--FWINGVTEVPQEKLDA 135

  Fly   134 ---AFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVA-GFDFKRYANVARWYENAKKLTPGW 194
               ..:.|.|||....|.||...:|||::...|||....| ..|...|..|..|.:...||....
  Fly   136 VHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYK 200

  Fly   195 EENWAGCQEF 204
            |.|.|..|.:
  Fly   201 EINEAPAQSY 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 30/70 (43%)
PLN02473 3..196 CDD:166114 73/195 (37%)
GST_C_Delta_Epsilon 89..205 CDD:198287 38/120 (32%)
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 30/70 (43%)
GstA 8..197 CDD:223698 72/190 (38%)
GST_C_Delta_Epsilon 94..210 CDD:198287 38/117 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460284
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_103768
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.