DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GstE10

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster


Alignment Length:220 Identity:72/220 - (32%)
Similarity:118/220 - (53%) Gaps:15/220 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESR 67
            ||....|.|.|:||:|.:||.::.:..| ::.:|.:...|:.|:.|||||:|.|.|....:|:|.
  Fly     6 LYGTESSPPVRAVLLTLRALQLDHEFHT-LDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDSH 69

  Fly    68 AIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANE---ENYK 129
            ||:.|||.||.:.|:|:|||..|:|:::|||:|:.|.|:....:.....:| |:.|.|   :...
  Fly    70 AIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALF-KENATEVPKDRLA 133

  Fly   130 KIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVA--GFDFKRYANVARWYENAKKLTP 192
            :::.|:..|..||....|.||...::||.:.:|||||..::  ..|..:|..::.|......|..
  Fly   134 ELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISALPF 198

  Fly   193 GWEENWAGCQ--------EFRKYFD 209
            ..|:|..|.:        :..|.||
  Fly   199 YEEDNLRGARLLADKIRSKLPKQFD 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 28/71 (39%)
PLN02473 3..196 CDD:166114 66/197 (34%)
GST_C_Delta_Epsilon 89..205 CDD:198287 33/128 (26%)
GstE10NP_001286570.1 GstA 4..197 CDD:223698 65/192 (34%)
GST_N_Delta_Epsilon 4..77 CDD:239343 28/71 (39%)
GST_C_Delta_Epsilon 91..211 CDD:198287 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460275
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.