DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD10 and GstE14

DIOPT Version :9

Sequence 1:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:214 Identity:59/214 - (27%)
Similarity:115/214 - (53%) Gaps:13/214 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESR 67
            |||...|.|.||.||..|.|.::.:.: .:|....|||..::|.:||||::|||......|.:|.
  Fly     8 LYYDERSPPVRSCLMLIKLLDIDVELR-FVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSH 71

  Fly    68 AIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQI---FLKKPANEE--- 126
            ||:::|.||:.:...|:|::..::..:...|.|:...|::..|::....:   |    ||.:   
  Fly    72 AILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGF----ANVDVAH 132

  Fly   127 NYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLT 191
            :.:|:..|:..:..:||...:.||...:|||::.:.|:||.::. |...::..:.||:...::| 
  Fly   133 HERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLM-FPLSQFPRLRRWFTAMQQL- 195

  Fly   192 PGWEENWAGCQEFRKYFDN 210
            ..:|.|.:|.::.|:..::
  Fly   196 DAYEANCSGLEKLRQTMES 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 28/71 (39%)
PLN02473 3..196 CDD:166114 55/198 (28%)
GST_C_Delta_Epsilon 89..205 CDD:198287 26/121 (21%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 55/198 (28%)
GST_N_Delta_Epsilon 6..79 CDD:239343 28/71 (39%)
GST_C_Delta_Epsilon 94..209 CDD:198287 26/120 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.